PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.20256s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 163aa    MW: 18342.7 Da    PI: 8.0721
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.20256s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1085e-343791155
               G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                          kprlrWt+eLHerF++av+qLGG++kAtPkti+++m+vkgLtl+h+kSHLQk+Rl
  Araha.20256s0002.1.p 37 KPRLRWTSELHERFIDAVTQLGGPDKATPKTIMRTMGVKGLTLYHLKSHLQKFRL 91
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.7063494IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-323493IPR009057Homeodomain-like
SuperFamilySSF466892.87E-173693IPR009057Homeodomain-like
TIGRFAMsTIGR015578.7E-253792IPR006447Myb domain, plants
PfamPF002494.2E-83989IPR001005SANT/Myb domain
PfamPF143792.9E-10135163IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MYSAIRSSLP LDGSLGDYSD GTNLPIDACL VLTTDPKPRL RWTSELHERF IDAVTQLGGP  60
DKATPKTIMR TMGVKGLTLY HLKSHLQKFR LGRQSCKESI DNSKDVSCVA ESQDTSSSST  120
SSLRLVAQEQ NESYQVTEAL RAQMEVQRRL HEQLEYAQVQ RRL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2264430.0AK226443.1 Arabidopsis thaliana mRNA for hypothetical protein, complete cds, clone: RAFL06-12-H15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006284218.11e-116hypothetical protein CARUB_v10005375mg
SwissprotQ9SAK55e-52APL_ARATH; Myb family transcription factor APL
TrEMBLR0F6H81e-116R0F6H8_9BRAS; Uncharacterized protein
STRINGAT4G13640.21e-115(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35152561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.21e-114G2-like family protein